SCOPe 2.08: Domain d2gvce2: 2gvc E:181-287

Lineage for d2gvce2 (2gvc E:181-287)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Flavin-dependent monoxygenase SPBP16F5.08c, middle domain [418941] (1 species)
7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [419393] (3 PDB entries)
   Uniprot Q9HFE4

8. Domain d2gvce2: 2gvc E:181-287 [135770]
   Other proteins in same PDB: d2gvca1, d2gvcb1, d2gvcd1, d2gvce1
   automatically matched to d1vqwa2
   complexed with fad, gol, mmz, peo

Details for d2gvce2

PDB Entry: 2gvc, 2.22 Å

PDB Description: crystal structure of flavin-containing monooxygenase (fmo)from s.pombe and substrate (methimazole) complex

PDB Compounds: (E:) monooxygenase

SCOPe Domain Sequences for d2gvce2:

Sequence; same for both SEQRES and ATOM records:

>d2gvce2 c.3.1.5 (E:181-287) Flavin-dependent monoxygenase SPBP16F5.08c, middle domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyc

Timeline for d2gvce2:

• d2gvce2 first appeared in SCOP 1.73
  
• d2gvce2 appears in SCOPe 2.07