![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Domain d2gvcd2: 2gvc D:181-287 [135768] Other proteins in same PDB: d2gvca1, d2gvcb1, d2gvcd1, d2gvce1 automatically matched to d1vqwa2 complexed with fad, gol, mmz, peo |
PDB Entry: 2gvc (more details), 2.22 Å
SCOPe Domain Sequences for d2gvcd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gvcd2 c.3.1.5 (D:181-287) Flavin-dependent monoxygenase SPBP16F5.08c, middle domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyc
Timeline for d2gvcd2: