Lineage for d2gvcb1 (2gvc B:3-180,B:288-444)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849963Protein Flavin-dependent monoxygenase SPBP16F5.08c, N- and C-terminal domain [418940] (1 species)
  7. 2849964Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [419392] (3 PDB entries)
    Uniprot Q9HFE4
  8. 2849968Domain d2gvcb1: 2gvc B:3-180,B:288-444 [135765]
    Other proteins in same PDB: d2gvca2, d2gvcb2, d2gvcd2, d2gvce2
    automatically matched to d1vqwa1
    complexed with fad, gol, mmz, peo

    has additional insertions and/or extensions that are not grouped together

Details for d2gvcb1

PDB Entry: 2gvc (more details), 2.22 Å

PDB Description: crystal structure of flavin-containing monooxygenase (fmo)from s.pombe and substrate (methimazole) complex
PDB Compounds: (B:) monooxygenase

SCOPe Domain Sequences for d2gvcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gvcb1 c.3.1.5 (B:3-180,B:288-444) Flavin-dependent monoxygenase SPBP16F5.08c, N- and C-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyXt
gylysvpfpslaklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqa
qaaflarvwsgrlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckq
atpvleeefpspywgekersirenmwsirakffgie

SCOPe Domain Coordinates for d2gvcb1:

Click to download the PDB-style file with coordinates for d2gvcb1.
(The format of our PDB-style files is described here.)

Timeline for d2gvcb1: