| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Domain d2gv8b2: 2gv8 B:181-287 [135762] Other proteins in same PDB: d2gv8a1, d2gv8b1 automatically matched to d1vqwa2 complexed with fad, gol, ndp |
PDB Entry: 2gv8 (more details), 2.1 Å
SCOPe Domain Sequences for d2gv8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gv8b2 c.3.1.5 (B:181-287) Flavin-dependent monoxygenase SPBP16F5.08c, middle domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
ipnikgldeyakavpgsvlhsslfrepelfvgesvlvvggassandlvrhltpvakhpiy
qsllgggdiqneslqqvpeitkfdpttreiylkggkvlsnidrviyc
Timeline for d2gv8b2: