Lineage for d2gv8b1 (2gv8 B:3-180,B:288-444)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 689104Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 689166Protein Flavin-dependent monoxygenase SPBP16F5.08c [117444] (1 species)
  7. 689167Species Schizosaccharomyces pombe [TaxId:4896] [117445] (3 PDB entries)
  8. 689182Domain d2gv8b1: 2gv8 B:3-180,B:288-444 [135761]
    automatically matched to d1vqwa1
    complexed with fad, gol, ndp

Details for d2gv8b1

PDB Entry: 2gv8 (more details), 2.1 Å

PDB Description: crystal structure of flavin-containing monooxygenase (fmo) from s.pombe and nadph cofactor complex
PDB Compounds: (B:) monooxygenase

SCOP Domain Sequences for d2gv8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gv8b1 c.3.1.5 (B:3-180,B:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]}
lptirkiaiigagpsglvtakallaekafdqvtlferrgspggvwnytstlsnklpvpst
npilttepivgpaalpvypsplyrdlqtntpielmgycdqsfkpqtlqfphrhtiqeyqr
iyaqpllpfiklatdvldiekkdgswvvtykgtkagspiskdifdavsicnghyevpyXt
gylysvpfpslaklkspetkliddgshvhnvyqhifyipdptlafvglalhvvpfptsqa
qaaflarvwsgrlklpskeeqlkwqdelmfslsgannmyhsldypkdatyinklhdwckq
atpvleeefpspywgekersirenmwsirakffgie

SCOP Domain Coordinates for d2gv8b1:

Click to download the PDB-style file with coordinates for d2gv8b1.
(The format of our PDB-style files is described here.)

Timeline for d2gv8b1:

Domains from same chain:
(mouse over for more information)
d2gv8b2
Domains from other chains:
(mouse over for more information)
d2gv8a1, d2gv8a2