Lineage for d2gv2a1 (2gv2 A:25-109)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641571Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 641572Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family) (S)
    binds to the transactivation domain of human p53
  5. 641573Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins)
    Pfam PF02201
  6. 641580Protein MDM2 [47594] (2 species)
  7. 641584Species Human (Homo sapiens) [TaxId:9606] [47596] (6 PDB entries)
  8. 641586Domain d2gv2a1: 2gv2 A:25-109 [135756]
    automatically matched to d1ycra_
    complexed with 1ac, 6cw, ace, pm3

Details for d2gv2a1

PDB Entry: 2gv2 (more details), 1.8 Å

PDB Description: MDM2 in complex with an 8-mer p53 peptide analogue
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOP Domain Sequences for d2gv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gv2a1 a.42.1.1 (A:25-109) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

SCOP Domain Coordinates for d2gv2a1:

Click to download the PDB-style file with coordinates for d2gv2a1.
(The format of our PDB-style files is described here.)

Timeline for d2gv2a1: