Lineage for d2gv2a_ (2gv2 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712363Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily)
    core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets
    duplication: consists of two structural repeats
  4. 2712364Superfamily a.42.1: SWIB/MDM2 domain [47592] (2 families) (S)
    binds to the transactivation domain of human p53
  5. 2712365Family a.42.1.1: SWIB/MDM2 domain [47593] (5 proteins)
    Pfam PF02201
  6. 2712372Protein MDM2 [47594] (2 species)
  7. 2712390Species Human (Homo sapiens) [TaxId:9606] [47596] (76 PDB entries)
  8. 2712405Domain d2gv2a_: 2gv2 A: [135756]
    automated match to d1rv1a_

Details for d2gv2a_

PDB Entry: 2gv2 (more details), 1.8 Å

PDB Description: MDM2 in complex with an 8-mer p53 peptide analogue
PDB Compounds: (A:) ubiquitin-protein ligase e3 mdm2

SCOPe Domain Sequences for d2gv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gv2a_ a.42.1.1 (A:) MDM2 {Human (Homo sapiens) [TaxId: 9606]}
etlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvvvnq

SCOPe Domain Coordinates for d2gv2a_:

Click to download the PDB-style file with coordinates for d2gv2a_.
(The format of our PDB-style files is described here.)

Timeline for d2gv2a_: