| Class b: All beta proteins [48724] (180 folds) |
| Fold b.77: beta-Prism I [51091] (4 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) ![]() |
| Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins) |
| Protein Griffithsin [141569] (2 species) single-chain subunits form a segment-swapped dimer |
| Species Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries) Uniprot P84801 1-121 |
| Domain d2guxa1: 2gux A:1-121 [135753] Other proteins in same PDB: d2guxa2 complexed with so4 |
PDB Entry: 2gux (more details), 2 Å
SCOPe Domain Sequences for d2guxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2guxa1 b.77.3.1 (A:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y
Timeline for d2guxa1: