Lineage for d2guua1 (2guu A:21-352)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2413882Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 2414001Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 2414018Species Plasmodium vivax [TaxId:5855] [141750] (1 PDB entry)
  8. 2414019Domain d2guua1: 2guu A:21-352 [135747]
    complexed with up6

Details for d2guua1

PDB Entry: 2guu (more details), 1.86 Å

PDB Description: crystal structure of plasmodium vivax orotidine 5-monophosphate decarboxylase with 6-aza-ump bound
PDB Compounds: (A:) ODcase

SCOPe Domain Sequences for d2guua1:

Sequence, based on SEQRES records: (download)

>d2guua1 c.1.2.3 (A:21-352) Protozoan orotidine monophosphate decarboxylase {Plasmodium vivax [TaxId: 5855]}
lkiklqkrrdevntclcigldpdeadiksfmqsekqngyqsvkknlsnsgssssssnsss
gkgelfapqmggqmllaetppkeaqekdeffyffnhfcfyiinetkeyalaykmnfafyl
pygslgvdvlknvfdylhhlnvptildikmndigntvkhyrkfifdylrsdsctaniymg
tqmlrdicldeeckryystfvlvkttnadshifqnrlsldgkeayvviaeeaqkmakqlh
leengefvgfvvgancydeikkirelfpdcyilapgvgaqkgdlrkmlcngysknyekvl
invgraitksgspqqaareyhqqikevlaelq

Sequence, based on observed residues (ATOM records): (download)

>d2guua1 c.1.2.3 (A:21-352) Protozoan orotidine monophosphate decarboxylase {Plasmodium vivax [TaxId: 5855]}
lkiklqkrrdevntclcigldpdeadiksfmqsekqngyqsvkknlsnsgelfapqmggq
mllaetppkeaqekdeffyffnhfcfyiinetkeyalaykmnfafylpygslgvdvlknv
fdylhhlnvptildikmndigntvkhyrkfifdylrsdsctaniymgtqmlrdicldckr
yystfvlvkttnadshifqnrlsldgkeayvviaeeaqkmakqlhleengefvgfvvgan
cydeikkirelfpdcyilapgvgaqkgdlrkmlcngysknyekvlinvgraitksgspqq
aareyhqqikevlaelq

SCOPe Domain Coordinates for d2guua1:

Click to download the PDB-style file with coordinates for d2guua1.
(The format of our PDB-style files is described here.)

Timeline for d2guua1: