SCOPe 2.07: Domain d2guia_: 2gui A:

Lineage for d2guia_ (2gui A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (6 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187263] (14 PDB entries)

8. Domain d2guia_: 2gui A: [135737]
   automated match to d1j53a_
   complexed with edo, mn, peg, u5p

Details for d2guia_

PDB Entry: 2gui, 1.6 Å

PDB Description: structure and function of cyclized versions of the proofreading exonuclease subunit of e. coli dna polymerase iii

PDB Compounds: (A:) DNA polymerase III epsilon subunit

SCOPe Domain Sequences for d2guia_:

Sequence; same for both SEQRES and ATOM records:

>d2guia_ c.55.3.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
itrqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafg
vhgiadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntf
ckvtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

Timeline for d2guia_:

• d2guia_ first appeared in SCOP 1.73, called d2guia1
  
• d2guia_ appears in SCOPe 2.06
  
• d2guia_ appears in the current release, SCOPe 2.08