Lineage for d2guia1 (2gui A:7-180)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701966Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) (S)
    consists of one domain of this fold
  5. 702237Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (14 proteins)
    contains Pfam PF00929
  6. 702415Protein N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III [82444] (1 species)
  7. 702416Species Escherichia coli [TaxId:562] [82445] (4 PDB entries)
  8. 702417Domain d2guia1: 2gui A:7-180 [135737]
    automatically matched to d1j53a_
    complexed with egl, mn, peg, u5p

Details for d2guia1

PDB Entry: 2gui (more details), 1.6 Å

PDB Description: structure and function of cyclized versions of the proofreading exonuclease subunit of e. coli dna polymerase iii
PDB Compounds: (A:) DNA polymerase III epsilon subunit

SCOP Domain Sequences for d2guia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2guia1 c.55.3.5 (A:7-180) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh
giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck
vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

SCOP Domain Coordinates for d2guia1:

Click to download the PDB-style file with coordinates for d2guia1.
(The format of our PDB-style files is described here.)

Timeline for d2guia1: