SCOPe 2.07: Domain d2gudb1: 2gud B:1-121

Lineage for d2gudb1 (2gud B:1-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.77: beta-Prism I [51091] (3 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.1: Mannose-binding lectins [51102] (7 proteins)

6. Protein Griffithsin [141569] (2 species)
   single-chain subunits form a segment-swapped dimer

7. Species Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries)
   Uniprot P84801 1-121

8. Domain d2gudb1: 2gud B:1-121 [135733]
   automatically matched to 2GTY A:1-121
   complexed with bma, edo, man, so4

Details for d2gudb1

PDB Entry: 2gud, 0.94 Å

PDB Description: crystal structure of a complex of griffithsin with mannose at 0.94 a resolution

PDB Compounds: (B:) Griffithsin

SCOPe Domain Sequences for d2gudb1:

Sequence; same for both SEQRES and ATOM records:

>d2gudb1 b.77.3.1 (B:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

Timeline for d2gudb1:

• d2gudb1 first appeared in SCOP 1.73
  
• d2gudb1 appears in SCOPe 2.06
  
• d2gudb1 appears in the current release, SCOPe 2.08