Lineage for d2gu7b1 (2gu7 B:4-264)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732939Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 732940Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 732941Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 732993Protein Methionine aminopeptidase [55924] (5 species)
  7. 733002Species Escherichia coli [TaxId:562] [55925] (29 PDB entries)
  8. 733032Domain d2gu7b1: 2gu7 B:4-264 [135728]
    automatically matched to d1mat__
    complexed with mn, na

Details for d2gu7b1

PDB Entry: 2gu7 (more details), 2 Å

PDB Description: E. coli methionine aminopeptidase unliganded, 1:0.5
PDB Compounds: (B:) Methionine aminopeptidase

SCOP Domain Sequences for d2gu7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gu7b1 d.127.1.1 (B:4-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

SCOP Domain Coordinates for d2gu7b1:

Click to download the PDB-style file with coordinates for d2gu7b1.
(The format of our PDB-style files is described here.)

Timeline for d2gu7b1: