Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein Methionine aminopeptidase [55924] (7 species) |
Species Escherichia coli [TaxId:562] [55925] (32 PDB entries) Uniprot P07906 |
Domain d2gu7b_: 2gu7 B: [135728] automated match to d1mat__ complexed with mn, na |
PDB Entry: 2gu7 (more details), 2 Å
SCOPe Domain Sequences for d2gu7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gu7b_ d.127.1.1 (B:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn gceiltlrkddtipaiishde
Timeline for d2gu7b_: