SCOPe 2.01: Domain d2gu7a_: 2gu7 A:

Lineage for d2gu7a_ (2gu7 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (6 species)

7. Species Escherichia coli [TaxId:562] [55925] (29 PDB entries)
   Uniprot P07906

8. Domain d2gu7a_: 2gu7 A: [135727]
   automated match to d1mat__
   complexed with mn, na

Details for d2gu7a_

PDB Entry: 2gu7, 2 Å

PDB Description: e. coli methionine aminopeptidase unliganded, 1:0.5

PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gu7a_:

Sequence; same for both SEQRES and ATOM records:

>d2gu7a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

Timeline for d2gu7a_:

• d2gu7a_ first appeared in SCOP 1.73, called d2gu7a1
  
• d2gu7a_ was called d2gu7a1 in SCOP 1.75
  
• d2gu7a_ appears in SCOPe 2.02
  
• d2gu7a_ appears in the current release, SCOPe 2.08