Lineage for d2gu7a_ (2gu7 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974613Protein Methionine aminopeptidase [55924] (7 species)
  7. 2974624Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
    Uniprot P07906
  8. 2974656Domain d2gu7a_: 2gu7 A: [135727]
    automated match to d1mat__
    complexed with mn, na

Details for d2gu7a_

PDB Entry: 2gu7 (more details), 2 Å

PDB Description: e. coli methionine aminopeptidase unliganded, 1:0.5
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gu7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gu7a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

SCOPe Domain Coordinates for d2gu7a_:

Click to download the PDB-style file with coordinates for d2gu7a_.
(The format of our PDB-style files is described here.)

Timeline for d2gu7a_: