Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein Methionine aminopeptidase [55924] (6 species) |
Species Escherichia coli [TaxId:562] [55925] (32 PDB entries) Uniprot P07906 |
Domain d2gu6a_: 2gu6 A: [135725] automated match to d1mat__ complexed with mn, na, nlp |
PDB Entry: 2gu6 (more details), 1.7 Å
SCOPe Domain Sequences for d2gu6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gu6a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn gceiltlrkddtipaiishde
Timeline for d2gu6a_: