SCOP 1.73: Domain d2gu4a1: 2gu4 A:4-264

Lineage for d2gu4a1 (2gu4 A:4-264)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)

6. Protein Methionine aminopeptidase [55924] (5 species)

7. Species Escherichia coli [TaxId:562] [55925] (29 PDB entries)

8. Domain d2gu4a1: 2gu4 A:4-264 [135721]
   automatically matched to d1mat__
   complexed with mn, na

Details for d2gu4a1

PDB Entry: 2gu4, 1.8 Å

PDB Description: e. coli methionine aminopeptidase in complex with nlep, 1: 0.5, di- metalated

PDB Compounds: (A:) Methionine aminopeptidase

SCOP Domain Sequences for d2gu4a1:

Sequence; same for both SEQRES and ATOM records:

>d2gu4a1 d.127.1.1 (A:4-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

Timeline for d2gu4a1:

• d2gu4a1 is new in SCOP 1.73
  
• d2gu4a1 appears in SCOP 1.75
  
• d2gu4a1 appears in the current release, SCOPe 2.08, called d2gu4a_