Lineage for d2gu4a_ (2gu4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974613Protein Methionine aminopeptidase [55924] (7 species)
  7. 2974624Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
    Uniprot P07906
  8. 2974647Domain d2gu4a_: 2gu4 A: [135721]
    automated match to d1mat__
    complexed with mn, na, nlp

Details for d2gu4a_

PDB Entry: 2gu4 (more details), 1.8 Å

PDB Description: e. coli methionine aminopeptidase in complex with nlep, 1: 0.5, di- metalated
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gu4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gu4a_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

SCOPe Domain Coordinates for d2gu4a_:

Click to download the PDB-style file with coordinates for d2gu4a_.
(The format of our PDB-style files is described here.)

Timeline for d2gu4a_: