SCOP 1.73: Domain d2gtzd2: 2gtz D:1-181

Lineage for d2gtzd2 (2gtz D:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries)

8. Domain d2gtzd2: 2gtz D:1-181 [135719]
   Other proteins in same PDB: d2gtza1, d2gtzb1, d2gtzd1, d2gtze1
   automatically matched to d1akja2
   complexed with gol, na; mutant

Details for d2gtzd2

PDB Entry: 2gtz, 1.7 Å

PDB Description: human class i mhc hla-a2 in complex with the nonameric melan-a/mart- 1(27-35) peptide having a28l substitution

PDB Compounds: (D:) HLA-A*0201 heavy chain

SCOP Domain Sequences for d2gtzd2:

Sequence; same for both SEQRES and ATOM records:

>d2gtzd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d2gtzd2:

• d2gtzd2 is new in SCOP 1.73
  
• d2gtzd2 appears in SCOP 1.75
  
• d2gtzd2 appears in the current release, SCOPe 2.08