Lineage for d2gtzd2 (2gtz D:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937696Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. 2937713Domain d2gtzd2: 2gtz D:1-181 [135719]
    Other proteins in same PDB: d2gtza1, d2gtzb2, d2gtzb3, d2gtzd1, d2gtze2, d2gtze3
    automatically matched to d1akja2
    complexed with gol, na

Details for d2gtzd2

PDB Entry: 2gtz (more details), 1.7 Å

PDB Description: human class i mhc hla-a2 in complex with the nonameric melan-a/mart- 1(27-35) peptide having a28l substitution
PDB Compounds: (D:) HLA-A*0201 heavy chain

SCOPe Domain Sequences for d2gtzd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtzd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2gtzd2:

Click to download the PDB-style file with coordinates for d2gtzd2.
(The format of our PDB-style files is described here.)

Timeline for d2gtzd2: