| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries) Uniprot P01892 25-298 |
| Domain d2gtza2: 2gtz A:1-181 [135716] Other proteins in same PDB: d2gtza1, d2gtzb_, d2gtzd1, d2gtze_ automatically matched to d1akja2 complexed with gol, na |
PDB Entry: 2gtz (more details), 1.7 Å
SCOPe Domain Sequences for d2gtza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r
Timeline for d2gtza2:
View in 3DDomains from other chains: (mouse over for more information) d2gtzb_, d2gtzd1, d2gtzd2, d2gtze_ |