Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (62 PDB entries) |
Domain d2gtza2: 2gtz A:1-181 [135716] Other proteins in same PDB: d2gtza1, d2gtzb1, d2gtzd1, d2gtze1 automatically matched to d1akja2 complexed with gol, na; mutant |
PDB Entry: 2gtz (more details), 1.7 Å
SCOP Domain Sequences for d2gtza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d2gtza2:
View in 3D Domains from other chains: (mouse over for more information) d2gtzb1, d2gtzd1, d2gtzd2, d2gtze1 |