Lineage for d2gtza2 (2gtz A:1-181)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. Domain d2gtza2: 2gtz A:1-181 [135716]
    Other proteins in same PDB: d2gtza1, d2gtzb2, d2gtzb3, d2gtzd1, d2gtze2, d2gtze3
    automatically matched to d1akja2
    complexed with gol, na

Details for d2gtza2

PDB Entry: 2gtz (more details), 1.7 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the nonameric Melan-A/MART-1(27-35) peptide having A28L substitution
PDB Compounds: (A:) HLA-A*0201 heavy chain

SCOPe Domain Sequences for d2gtza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2gtza2 are not available.

Timeline for d2gtza2:

Domains from same chain:
(mouse over for more information)
d2gtza1
Domains from other chains:
(mouse over for more information)
d2gtzb2, d2gtzb3, d2gtzd1, d2gtzd2, d2gtze2, d2gtze3