Lineage for d2gtya1 (2gty A:1-121)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402521Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2402563Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2402564Family b.77.3.1: Mannose-binding lectins [51102] (7 protein domains)
  6. 2402605Protein Griffithsin [141569] (2 species)
    single-chain subunits form a segment-swapped dimer
  7. 2402609Species Red alga (Griffithsia) [TaxId:35158] [141570] (7 PDB entries)
    Uniprot P84801 1-121
  8. 2402612Domain d2gtya1: 2gty A:1-121 [135713]
    complexed with edo, so4

Details for d2gtya1

PDB Entry: 2gty (more details), 1.3 Å

PDB Description: Crystal structure of unliganded griffithsin
PDB Compounds: (A:) Griffithsin

SCOPe Domain Sequences for d2gtya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtya1 b.77.3.1 (A:1-121) Griffithsin {Red alga (Griffithsia) [TaxId: 35158]}
slthrkfggsggspfsglssiavrsgsyldaiiidgvhhggsggnlsptftfgsgeyisn
mtirsgdyidnisfetnmgrrfgpyggsggsantlsnvkviqingsagdyldsldiyyeq
y

SCOPe Domain Coordinates for d2gtya1:

Click to download the PDB-style file with coordinates for d2gtya1.
(The format of our PDB-style files is described here.)

Timeline for d2gtya1: