Lineage for d2gtxb_ (2gtx B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581092Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2581093Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2581094Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2581143Protein Methionine aminopeptidase [55924] (6 species)
  7. 2581154Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
    Uniprot P07906
  8. 2581189Domain d2gtxb_: 2gtx B: [135712]
    automated match to d1mat__
    complexed with mn, na, nlp

Details for d2gtxb_

PDB Entry: 2gtx (more details), 2 Å

PDB Description: structural basis of catalysis by mononuclear methionine aminopeptidase
PDB Compounds: (B:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gtxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtxb_ d.127.1.1 (B:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

SCOPe Domain Coordinates for d2gtxb_:

Click to download the PDB-style file with coordinates for d2gtxb_.
(The format of our PDB-style files is described here.)

Timeline for d2gtxb_: