SCOPe 2.08: Domain d2gtxa_: 2gtx A:

Lineage for d2gtxa_ (2gtx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
   duplication: composed of two very similar alpha+beta folds

4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families)

5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)

6. Protein Methionine aminopeptidase [55924] (7 species)

7. Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
   Uniprot P07906

8. Domain d2gtxa_: 2gtx A: [135711]
   automated match to d1mat__
   complexed with mn, na, nlp

Details for d2gtxa_

PDB Entry: 2gtx, 2 Å

PDB Description: structural basis of catalysis by mononuclear methionine aminopeptidase

PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gtxa_:

Sequence; same for both SEQRES and ATOM records:

>d2gtxa_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

Timeline for d2gtxa_:

• d2gtxa_ first appeared in SCOP 1.73, called d2gtxa1
  
• d2gtxa_ appears in SCOPe 2.07