Lineage for d2gtxa_ (2gtx A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. Protein Methionine aminopeptidase [55924] (7 species)
  7. Species Escherichia coli [TaxId:562] [55925] (32 PDB entries)
    Uniprot P07906
  8. Domain d2gtxa_: 2gtx A: [135711]
    automated match to d1mat__
    complexed with mn, na, nlp

Details for d2gtxa_

PDB Entry: 2gtx (more details), 2 Å

PDB Description: structural basis of catalysis by mononuclear methionine aminopeptidase
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d2gtxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtxa_ d.127.1.1 (A:) Methionine aminopeptidase {Escherichia coli [TaxId: 562]}
siktpediekmrvagrlaaevlemiepyvkpgvstgeldricndyivneqhavsaclgyh
gypksvcisinevvchgipddakllkdgdivnidvtvikdgfhgdtskmfivgkptimge
rlcritqeslylalrmvkpginlreigaaiqkfveaegfsvvreycghgigrgfheepqv
lhydsretnvvlkpgmtftiepmvnagkkeirtmkdgwtvktkdrslsaqyehtivvtdn
gceiltlrkddtipaiishde

SCOPe Domain Coordinates for d2gtxa_ are not available.

Timeline for d2gtxa_:

Domains from other chains:
(mouse over for more information)
d2gtxb_