![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d2gtwb2: 2gtw B:1-99 [135707] Other proteins in same PDB: d2gtwa1, d2gtwa2, d2gtwb3, d2gtwd1, d2gtwd2, d2gtwe3 automated match to d1a9bb_ complexed with fmt, gol, na |
PDB Entry: 2gtw (more details), 1.55 Å
SCOPe Domain Sequences for d2gtwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtwb2 b.1.1.2 (B:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d2gtwb2: