Lineage for d2gtwa2 (2gtw A:1-181)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (104 PDB entries)
    Uniprot P01892 25-298
  8. Domain d2gtwa2: 2gtw A:1-181 [135706]
    Other proteins in same PDB: d2gtwa1, d2gtwb2, d2gtwb3, d2gtwd1, d2gtwe2, d2gtwe3
    automatically matched to d1akja2
    complexed with fmt, gol, na

Details for d2gtwa2

PDB Entry: 2gtw (more details), 1.55 Å

PDB Description: Human Class I MHC HLA-A2 in complex with the nonameric Melan-A/MART-1(27-35) peptide having A27L substitution
PDB Compounds: (A:) HLA-A*0201 heavy chain

SCOPe Domain Sequences for d2gtwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtwa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2gtwa2 are not available.

Timeline for d2gtwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtwa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2gtwb2, d2gtwb3, d2gtwd1, d2gtwd2, d2gtwe2, d2gtwe3