Lineage for d2gtvx1 (2gtv X:1-93)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648923Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 648924Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 648956Family a.130.1.3: monomeric chorismate mutase [140942] (1 protein)
    "un-swapped" four-helical relative of the homodimeric chorismate mutase domain
  6. 648957Protein Chorismate mutase-like protein MJ0246 [140943] (1 species)
  7. 648958Species Methanococcus jannaschii [TaxId:2190] [140944] (1 PDB entry)
  8. 648959Domain d2gtvx1: 2gtv X:1-93 [135704]
    complexed with tsa

Details for d2gtvx1

PDB Entry: 2gtv (more details)

PDB Description: nmr structure of monomeric chorismate mutase from methanococcus jannaschii
PDB Compounds: (X:) chorismate mutase

SCOP Domain Sequences for d2gtvx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtvx1 a.130.1.3 (X:1-93) Chorismate mutase-like protein MJ0246 {Methanococcus jannaschii [TaxId: 2190]}
mieklaeirkkideidnkilkarwpwaekliaernslakdvaeiknqlgipindpereky
iydrirklckehnvdenigikifqrliehnkal

SCOP Domain Coordinates for d2gtvx1:

Click to download the PDB-style file with coordinates for d2gtvx1.
(The format of our PDB-style files is described here.)

Timeline for d2gtvx1: