Lineage for d2gtvx1 (2gtv X:1-101)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732552Family a.130.1.3: monomeric chorismate mutase [140942] (1 protein)
    "un-swapped" four-helical relative of the homodimeric chorismate mutase domain
    automatically mapped to Pfam PF01817
  6. 2732553Protein Chorismate mutase-like protein MJ0246 [140943] (1 species)
  7. 2732554Species Methanococcus jannaschii [TaxId:2190] [140944] (1 PDB entry)
    Uniprot Q57696 1-93
  8. 2732555Domain d2gtvx1: 2gtv X:1-101 [135704]
    Other proteins in same PDB: d2gtvx2
    complexed with tsa

Details for d2gtvx1

PDB Entry: 2gtv (more details)

PDB Description: nmr structure of monomeric chorismate mutase from methanococcus jannaschii
PDB Compounds: (X:) chorismate mutase

SCOPe Domain Sequences for d2gtvx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtvx1 a.130.1.3 (X:1-101) Chorismate mutase-like protein MJ0246 {Methanococcus jannaschii [TaxId: 2190]}
mieklaeirkkideidnkilkarwpwaekliaernslakdvaeiknqlgipindpereky
iydrirklckehnvdenigikifqrliehnkalqkqyleet

SCOPe Domain Coordinates for d2gtvx1:

Click to download the PDB-style file with coordinates for d2gtvx1.
(The format of our PDB-style files is described here.)

Timeline for d2gtvx1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gtvx2