![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
![]() | Superfamily a.130.1: Chorismate mutase II [48600] (5 families) ![]() |
![]() | Family a.130.1.3: monomeric chorismate mutase [140942] (1 protein) "un-swapped" four-helical relative of the homodimeric chorismate mutase domain automatically mapped to Pfam PF01817 |
![]() | Protein Chorismate mutase-like protein MJ0246 [140943] (1 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [140944] (1 PDB entry) Uniprot Q57696 1-93 |
![]() | Domain d2gtvx1: 2gtv X:1-101 [135704] Other proteins in same PDB: d2gtvx2 complexed with tsa |
PDB Entry: 2gtv (more details)
SCOPe Domain Sequences for d2gtvx1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtvx1 a.130.1.3 (X:1-101) Chorismate mutase-like protein MJ0246 {Methanococcus jannaschii [TaxId: 2190]} mieklaeirkkideidnkilkarwpwaekliaernslakdvaeiknqlgipindpereky iydrirklckehnvdenigikifqrliehnkalqkqyleet
Timeline for d2gtvx1: