Lineage for d2gttn1 (2gtt N:6-448)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651814Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
    multihelical, consist of two helical domains; each domain contains a buried helix
  4. 651815Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) (S)
  5. 651816Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (1 protein)
    Pfam PF00945; RNA-binding homooligomeric protein
  6. 651817Protein Nucleoprotein [140811] (2 species)
  7. 651818Species Rabies virus [TaxId:11292] [140812] (1 PDB entry)
  8. 651832Domain d2gttn1: 2gtt N:6-448 [135695]
    automatically matched to 2GTT A:6-448

Details for d2gttn1

PDB Entry: 2gtt (more details), 3.49 Å

PDB Description: crystal structure of the rabies virus nucleoprotein-rna complex
PDB Compounds: (N:) nucleoprotein

SCOP Domain Sequences for d2gttn1:

Sequence, based on SEQRES records: (download)

>d2gttn1 a.260.1.1 (N:6-448) Nucleoprotein {Rabies virus [TaxId: 11292]}
ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
dpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnwaltgg
meltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehh
tlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgf
ikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnav
ghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrffrdeke
lqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrshirryv
svssnhqarpnsfaeflnktyss

Sequence, based on observed residues (ATOM records): (download)

>d2gttn1 a.260.1.1 (N:6-448) Nucleoprotein {Rabies virus [TaxId: 11292]}
ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
dpddvcsylaaamqffegtcpedwtsygiviarkgdkivegnwaltggmeltrdptvpeh
aslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwsti
pnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyf
fhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymg
qvrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaelttrspe
avytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss

SCOP Domain Coordinates for d2gttn1:

Click to download the PDB-style file with coordinates for d2gttn1.
(The format of our PDB-style files is described here.)

Timeline for d2gttn1: