![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
![]() | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) ![]() this domain interrupts the G-protein common fold |
![]() | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
![]() | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries) |
![]() | Domain d2gtpb1: 2gtp B:61-181 [135680] Other proteins in same PDB: d2gtpa2, d2gtpb2, d2gtpc_, d2gtpd_ automatically matched to d1kjya1 complexed with alf, gdp, mg |
PDB Entry: 2gtp (more details), 2.55 Å
SCOPe Domain Sequences for d2gtpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtpb1 a.66.1.1 (B:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
Timeline for d2gtpb1:
![]() Domains from other chains: (mouse over for more information) d2gtpa1, d2gtpa2, d2gtpc_, d2gtpd_ |