SCOPe 2.03: Domain d2gtpb1: 2gtp B:61-181

Lineage for d2gtpb1 (2gtp B:61-181)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158559] (7 PDB entries)

8. Domain d2gtpb1: 2gtp B:61-181 [135680]
   Other proteins in same PDB: d2gtpa2, d2gtpb2, d2gtpc_, d2gtpd_
   automatically matched to d1kjya1
   complexed with alf, gdp, mg

Details for d2gtpb1

PDB Entry: 2gtp, 2.55 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1

PDB Compounds: (B:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2gtpb1:

Sequence; same for both SEQRES and ATOM records:

>d2gtpb1 a.66.1.1 (B:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d2gtpb1:

• d2gtpb1 first appeared in SCOP 1.73
  
• d2gtpb1 appears in SCOPe 2.02
  
• d2gtpb1 appears in SCOPe 2.04
  
• d2gtpb1 appears in the current release, SCOPe 2.08