Lineage for d2gtpa1 (2gtp A:61-181)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717222Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 2717223Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 2717224Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 2717225Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 2717250Species Human (Homo sapiens) [TaxId:9606] [158559] (9 PDB entries)
  8. 2717255Domain d2gtpa1: 2gtp A:61-181 [135678]
    Other proteins in same PDB: d2gtpa2, d2gtpb2, d2gtpc_, d2gtpd_
    automatically matched to d1kjya1
    complexed with alf, gdp, mg

Details for d2gtpa1

PDB Entry: 2gtp (more details), 2.55 Å

PDB Description: Crystal structure of the heterodimeric complex of human RGS1 and activated Gi alpha 1
PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2gtpa1:

Sequence, based on SEQRES records: (download)

>d2gtpa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Sequence, based on observed residues (ATOM records): (download)

>d2gtpa1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Human (Homo sapiens) [TaxId: 9606]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlamtaelagvi
krlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvkt

SCOPe Domain Coordinates for d2gtpa1:

Click to download the PDB-style file with coordinates for d2gtpa1.
(The format of our PDB-style files is described here.)

Timeline for d2gtpa1: