SCOP 1.75: Domain d2gtlo2: 2gtl O:60-100

Lineage for d2gtlo2 (2gtl O:60-100)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (1 family)

5. Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)

6. Protein Extracellular hemoglobin linker l3 subunit [144113] (1 species)

7. Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [144114] (1 PDB entry)
   Uniprot Q2I742 78-118

8. Domain d2gtlo2: 2gtl O:60-100 [135674]
   Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo3
   complexed with ca, cmo, hem, zn

Details for d2gtlo2

PDB Entry: 2gtl, 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution

PDB Compounds: (O:) Extracellular hemoglobin linker L3 subunit

SCOP Domain Sequences for d2gtlo2:

Sequence; same for both SEQRES and ATOM records:

>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
pscdehehqcggddpqcisklfvcdghndcrngedekdctl

Timeline for d2gtlo2:

• d2gtlo2 first appeared in SCOP 1.73
  
• d2gtlo2 appears in SCOPe 2.01
  
• d2gtlo2 appears in the current release, SCOPe 2.08