![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
![]() | Superfamily g.12.1: LDL receptor-like module [57424] (1 family) ![]() |
![]() | Family g.12.1.1: LDL receptor-like module [57425] (6 proteins) |
![]() | Protein Extracellular hemoglobin linker l3 subunit [144113] (1 species) |
![]() | Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [144114] (1 PDB entry) |
![]() | Domain d2gtlo2: 2gtl O:60-100 [135674] Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo3 complexed with ca, cmo, hem, zn |
PDB Entry: 2gtl (more details), 3.5 Å
SCOP Domain Sequences for d2gtlo2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} pscdehehqcggddpqcisklfvcdghndcrngedekdctl
Timeline for d2gtlo2: