Lineage for d2gtlo1 (2gtl O:101-222)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2415300Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2416143Superfamily b.61.7: Extracellular hemoglobin linker subunit, receptor domain [141480] (1 family) (S)
  5. 2416144Family b.61.7.1: Extracellular hemoglobin linker subunit, receptor domain [141481] (3 proteins)
  6. 2416148Protein Extracellular hemoglobin linker l3 subunit [141484] (1 species)
  7. 2416149Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [141485] (1 PDB entry)
    Uniprot Q2I742 119-240
  8. 2416150Domain d2gtlo1: 2gtl O:101-222 [135673]
    Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo2, d2gtlo3
    complexed with ca, cmo, hem, zn

Details for d2gtlo1

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (O:) Extracellular hemoglobin linker L3 subunit

SCOPe Domain Sequences for d2gtlo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtlo1 b.61.7.1 (O:101-222) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
ptkagdkfigdvcfdhctkrrpehmtlafesssiaafftpiadlhvhieiesetdedese
vsmpadgeysfadhrltihppeedglglvgefdgynfdrfvghivhelseevcaefifhr
kk

SCOPe Domain Coordinates for d2gtlo1:

Click to download the PDB-style file with coordinates for d2gtlo1.
(The format of our PDB-style files is described here.)

Timeline for d2gtlo1: