Class b: All beta proteins [48724] (177 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.7: Extracellular hemoglobin linker subunit, receptor domain [141480] (1 family) |
Family b.61.7.1: Extracellular hemoglobin linker subunit, receptor domain [141481] (3 proteins) |
Protein Extracellular hemoglobin linker l3 subunit [141484] (1 species) |
Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [141485] (1 PDB entry) Uniprot Q2I742 119-240 |
Domain d2gtlo1: 2gtl O:101-222 [135673] Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo2, d2gtlo3 complexed with ca, cmo, hem, zn |
PDB Entry: 2gtl (more details), 3.5 Å
SCOPe Domain Sequences for d2gtlo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtlo1 b.61.7.1 (O:101-222) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} ptkagdkfigdvcfdhctkrrpehmtlafesssiaafftpiadlhvhieiesetdedese vsmpadgeysfadhrltihppeedglglvgefdgynfdrfvghivhelseevcaefifhr kk
Timeline for d2gtlo1: