Lineage for d2gtln2 (2gtl N:61-101)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2637892Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 2637893Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 2637894Family g.12.1.1: LDL receptor-like module [57425] (7 proteins)
  6. 2637895Protein Extracellular hemoglobin linker l2 subunit [144111] (1 species)
  7. 2637896Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [144112] (1 PDB entry)
    Uniprot Q2I743 98-138
  8. 2637897Domain d2gtln2: 2gtl N:61-101 [135671]
    Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
    complexed with ca, cmo, hem, zn

Details for d2gtln2

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (N:) Extracellular hemoglobin linker L2 subunit

SCOPe Domain Sequences for d2gtln2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
hcekrtfqcggneqecisdllvcdghkdchnahdedpdvcd

SCOPe Domain Coordinates for d2gtln2:

Click to download the PDB-style file with coordinates for d2gtln2.
(The format of our PDB-style files is described here.)

Timeline for d2gtln2: