Lineage for d2gtln1 (2gtl N:102-229)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674477Superfamily b.61.7: Extracellular hemoglobin linker subunit, receptor domain [141480] (1 family) (S)
  5. 674478Family b.61.7.1: Extracellular hemoglobin linker subunit, receptor domain [141481] (3 proteins)
  6. 674479Protein Extracellular hemoglobin linker l2 subunit [141486] (1 species)
  7. 674480Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [141487] (1 PDB entry)
  8. 674481Domain d2gtln1: 2gtl N:102-229 [135670]
    Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
    complexed with ca, cmo, hem, zn

Details for d2gtln1

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (N:) Extracellular hemoglobin linker L2 subunit

SCOP Domain Sequences for d2gtln1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtln1 b.61.7.1 (N:102-229) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
tsvvkagnvfsgtstwhgclaredhvtrititaskrrkfftariwlralveselerhgen
vtssfnakgyynfasrrlillptddhddhlavvcsfnrgdneraechrvteatlhqcadl
fvtleehd

SCOP Domain Coordinates for d2gtln1:

Click to download the PDB-style file with coordinates for d2gtln1.
(The format of our PDB-style files is described here.)

Timeline for d2gtln1: