Lineage for d2gtlm3 (2gtl M:9-59)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2265467Fold h.1: Parallel coiled-coil [57943] (38 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2266800Superfamily h.1.32: Heterotrimerisation domain of extracellular hemoglobin linker subunits [144276] (1 family) (S)
  5. 2266801Family h.1.32.1: Heterotrimerisation domain of extracellular hemoglobin linker subunits [144277] (3 proteins)
  6. 2266808Protein Hemoglobin linker chain l1 [144282] (1 species)
  7. 2266809Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [144283] (1 PDB entry)
    Uniprot Q9GV76 24-84
  8. 2266810Domain d2gtlm3: 2gtl M:9-59 [135669]
    Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
    complexed with ca, cmo, hem, zn

Details for d2gtlm3

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (M:) Hemoglobin linker chain L1

SCOPe Domain Sequences for d2gtlm3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtlm3 h.1.32.1 (M:9-59) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
rfqylvknqnlhidylakklhdieeeynklthdvdkktirqlkarisnlee

SCOPe Domain Coordinates for d2gtlm3:

Click to download the PDB-style file with coordinates for d2gtlm3.
(The format of our PDB-style files is described here.)

Timeline for d2gtlm3: