Lineage for d2gtlj1 (2gtl J:1-145)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299552Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) [116754] (1 species)
  7. 2299553Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116755] (2 PDB entries)
    Uniprot P02218
  8. 2299559Domain d2gtlj1: 2gtl J:1-145 [135664]
    Other proteins in same PDB: d2gtla1, d2gtlc1, d2gtld1, d2gtle1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
    automatically matched to d1x9fb_
    complexed with ca, cmo, hem, zn

Details for d2gtlj1

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (J:) Extracellular globin 2

SCOPe Domain Sequences for d2gtlj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtlj1 a.1.1.2 (J:1-145) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
kkqcgvleglkvksewgraygsghdreafsqaiwratfaqvpesrslfkrvhgddtshpa
fiahadrvlggldiaistldqpatlkeeldhlqvqhegrkipdnyfdafktailhvvaaq
lgrcydreawdacidhiedgikghh

SCOPe Domain Coordinates for d2gtlj1:

Click to download the PDB-style file with coordinates for d2gtlj1.
(The format of our PDB-style files is described here.)

Timeline for d2gtlj1: