Lineage for d2gtlh1 (2gtl H:8-147)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686075Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 [116758] (1 species)
  7. 2686076Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116759] (2 PDB entries)
    Uniprot O61233 19-158
  8. 2686081Domain d2gtlh1: 2gtl H:8-147 [135662]
    Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtle1, d2gtlf1, d2gtlg1, d2gtli1, d2gtlj1, d2gtlk1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
    automatically matched to d1x9fd_
    complexed with ca, cmo, hem, zn

Details for d2gtlh1

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (H:) Hemoglobin chain d1

SCOPe Domain Sequences for d2gtlh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtlh1 a.1.1.2 (H:8-147) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
eclvteslkvklqwasafghahervafglelwrdiiddhpeikapfsrvrgdniyspefg
ahsqrvlsglditismldtpdmlaaqlahlkvqhvernlkpeffdiflkhllhvlgdrlg
thfdfgawhdcvdqiidgik

SCOPe Domain Coordinates for d2gtlh1:

Click to download the PDB-style file with coordinates for d2gtlh1.
(The format of our PDB-style files is described here.)

Timeline for d2gtlh1: