Lineage for d2gtlc1 (2gtl C:3-151)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758436Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) [116756] (1 species)
  7. 758437Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116757] (2 PDB entries)
    Uniprot P11069 20-168
  8. 758441Domain d2gtlc1: 2gtl C:3-151 [135657]
    Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtld1, d2gtle1, d2gtlf1, d2gtlh1, d2gtli1, d2gtlj1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
    automatically matched to d1x9fc_
    complexed with ca, cmo, hem, zn

Details for d2gtlc1

PDB Entry: 2gtl (more details), 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution
PDB Compounds: (C:) Extracellular globin-3

SCOP Domain Sequences for d2gtlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtlc1 a.1.1.2 (C:3-151) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
hehccseedhrivqkqwdilwrdtesskikigfgrllltklakdipevndlfkrvdieha
egpkfsahalrilngldlainllddppaldaaldhlahqhevregvqkahfkkfgeilat
glpqvlddydalawksclkgiltkissrl

SCOP Domain Coordinates for d2gtlc1:

Click to download the PDB-style file with coordinates for d2gtlc1.
(The format of our PDB-style files is described here.)

Timeline for d2gtlc1: