![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) [116754] (1 species) |
![]() | Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116755] (2 PDB entries) Uniprot P02218 |
![]() | Domain d2gtlb1: 2gtl B:1-145 [135656] Other proteins in same PDB: d2gtla1, d2gtlc1, d2gtld1, d2gtle1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtlm3, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3 automatically matched to d1x9fb_ complexed with ca, cmo, hem, zn |
PDB Entry: 2gtl (more details), 3.5 Å
SCOPe Domain Sequences for d2gtlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtlb1 a.1.1.2 (B:1-145) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} kkqcgvleglkvksewgraygsghdreafsqaiwratfaqvpesrslfkrvhgddtshpa fiahadrvlggldiaistldqpatlkeeldhlqvqhegrkipdnyfdafktailhvvaaq lgrcydreawdacidhiedgikghh
Timeline for d2gtlb1: