SCOPe 2.08: Domain d2gtia2: 2gti A:217-369

Lineage for d2gtia2 (2gti A:217-369)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)

4. Superfamily d.294.1: EndoU-like [142877] (3 families)
   similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
   PfamB PB001946

6. Protein Nsp15, C-terminal domain [142882] (2 species)

7. Species Murine hepatitis virus, MHV [TaxId:11138] [142884] (2 PDB entries)
   Uniprot P16342 6720-6872

8. Domain d2gtia2: 2gti A:217-369 [135653]
   Other proteins in same PDB: d2gtia1, d2gtia3
   complexed with gol, so4; mutant

Details for d2gtia2

PDB Entry: 2gti, 2.15 Å

PDB Description: mutation of mhv coronavirus non-structural protein nsp15 (f307l)

PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2gtia2:

Sequence; same for both SEQRES and ATOM records:

>d2gtia2 d.294.1.2 (A:217-369) Nsp15, C-terminal domain {Murine hepatitis virus, MHV [TaxId: 11138]}
argtiftqsrllssftprsemekdfmdldddvfiakyslqdyafehvvygsfnqkiiggl
hlliglarrqqksnlviqefvtydssihsylitdensgssksvctvidlllddfvdivks
lnlkcvskvvnvnvdfkdfqfmlwcneekvmtf

Timeline for d2gtia2:

• d2gtia2 first appeared in SCOP 1.73
  
• d2gtia2 appears in SCOPe 2.07