![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (2 proteins) rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain |
![]() | Protein Nsp15 [142626] (2 species) |
![]() | Species Murine hepatitis virus, MHV [TaxId:11138] [142627] (2 PDB entries) Uniprot P16342 6504-6697! Uniprot P16342 6697-6872 |
![]() | Domain d2gtia1: 2gti A:1-194 [135652] Other proteins in same PDB: d2gtia2, d2gtia3 complexed with gol, so4; mutant |
PDB Entry: 2gti (more details), 2.15 Å
SCOPe Domain Sequences for d2gtia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtia1 c.66.1.48 (A:1-194) Nsp15 {Murine hepatitis virus, MHV [TaxId: 11138]} slenvvynlvnaghfdgragelpcavigekviakiqnedvvvfknntpfptnvavelfak rsirphpelklfrnlnidvcwshvlwdyakdsvfcsstykvckytdlqcieslnvlfdgr dngaleafkkcrngvyinttkikslsmikgpqradlngvvvekvgdsdvefwfavrkdgd dvifsrtgslepsh
Timeline for d2gtia1: