Lineage for d2gtha2 (2gth A:217-369)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615811Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)
  4. 2615812Superfamily d.294.1: EndoU-like [142877] (3 families) (S)
    similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 2615821Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (2 proteins)
    PfamB PB001946
  6. 2615822Protein Nsp15, C-terminal domain [142882] (2 species)
  7. 2615823Species Murine hepatitis virus, MHV [TaxId:11138] [142884] (2 PDB entries)
    Uniprot P16342 6720-6872
  8. 2615825Domain d2gtha2: 2gth A:217-369 [135651]
    Other proteins in same PDB: d2gtha1, d2gtha3

Details for d2gtha2

PDB Entry: 2gth (more details), 2.7 Å

PDB Description: crystal structure of the wildtype MHV coronavirus non-structural protein nsp15
PDB Compounds: (A:) Replicase polyprotein 1ab

SCOPe Domain Sequences for d2gtha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gtha2 d.294.1.2 (A:217-369) Nsp15, C-terminal domain {Murine hepatitis virus, MHV [TaxId: 11138]}
argtiftqsrllssftprsemekdfmdldddvfiakyslqdyafehvvygsfnqkiiggl
hlliglarrqqksnlviqefvtydssihsyfitdensgssksvctvidlllddfvdivks
lnlkcvskvvnvnvdfkdfqfmlwcneekvmtf

SCOPe Domain Coordinates for d2gtha2:

Click to download the PDB-style file with coordinates for d2gtha2.
(The format of our PDB-style files is described here.)

Timeline for d2gtha2: