![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (scop_cf 54075) |
![]() | Superfamily d.294.1: EndoU-like [142877] (2 families) ![]() similarity to the RNase A-like superfamily (scop_sf 54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
![]() | Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (1 protein) PfamB 001946 |
![]() | Protein Nsp15, C-terminal domain [142882] (2 species) |
![]() | Species Murine hepatitis virus, MHV [TaxId:11138] [142884] (2 PDB entries) |
![]() | Domain d2gtha2: 2gth A:217-369 [135651] Other proteins in same PDB: d2gtha1 |
PDB Entry: 2gth (more details), 2.7 Å
SCOP Domain Sequences for d2gtha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtha2 d.294.1.2 (A:217-369) Nsp15, C-terminal domain {Murine hepatitis virus, MHV [TaxId: 11138]} argtiftqsrllssftprsemekdfmdldddvfiakyslqdyafehvvygsfnqkiiggl hlliglarrqqksnlviqefvtydssihsyfitdensgssksvctvidlllddfvdivks lnlkcvskvvnvnvdfkdfqfmlwcneekvmtf
Timeline for d2gtha2: